PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P13440_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 227aa    MW: 25030.3 Da    PI: 9.3607
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P13440_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1879132356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k+ +++keq + Lee F ++++++ +++e LA+kl+L  rqV vWFqNrRa+ k
  GSMUA_Achr4P13440_001  79 KKLRLSKEQSRLLEESFTQHHTLNPKQKEALAMKLELRPRQVEVWFQNRRARTK 132
                            67789***********************************************98 PP

2HD-ZIP_I/II1215.9e-3979166290
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kk+rlskeq++lLEesF+++++L+p++K++la +L+l+prqv+vWFqnrRARtk+k++E+++e+Lkr++ +l++en+rL++eveeLr 
  GSMUA_Achr4P13440_001  79 KKLRLSKEQSRLLEESFTQHHTLNPKQKEALAMKLELRPRQVEVWFQNRRARTKLKHTEMECEFLKRCFGSLTQENRRLQREVEELR- 165
                            9*************************************************************************************9. PP

            HD-ZIP_I/II  90 e 90 
                            +
  GSMUA_Achr4P13440_001 166 A 166
                            4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-1859135IPR009057Homeodomain-like
SuperFamilySSF466891.21E-1866134IPR009057Homeodomain-like
PROSITE profilePS5007116.69874134IPR001356Homeobox domain
SMARTSM003891.2E-1576138IPR001356Homeobox domain
CDDcd000868.59E-1577135No hitNo description
PfamPF000465.7E-1679132IPR001356Homeobox domain
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PfamPF021831.4E-8134167IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.9E-20134177IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MGSLGRSPSG LDLTIGVPGS SSSSSSSSPV WSGRLSFSGG GGGSMRDLDI NQPAYGGEED  60
YPMGSVDEEE EEGGTPRPKK LRLSKEQSRL LEESFTQHHT LNPKQKEALA MKLELRPRQV  120
EVWFQNRRAR TKLKHTEMEC EFLKRCFGSL TQENRRLQRE VEELRALRVA PPTVLSPHTR  180
QPLPASSLTM CPRCERVTAA PHLAPSSAGR HPFRRPATLP FAGIADG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396718.11e-152PREDICTED: homeobox-leucine zipper protein HOX3-like
SwissprotQ9XH384e-99HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
SwissprotQ0JKX14e-99HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
TrEMBLM0SNK91e-165M0SNK9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P13440_0011e-165(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.17e-60homeobox-leucine zipper protein 17